PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.352560.1
Common NameCsa_4G641690, LOC101218543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 197aa    MW: 21672.9 Da    PI: 8.512
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.352560.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.49e-20954147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Edell ++v+ +G+++W++I++ ++ gR++k+c++rw + 
   Cucsa.352560.1  9 KGPWSPDEDELLRRLVHNYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 54
                     79******************************.***********985 PP

2Myb_DNA-binding53.84.6e-1763105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T +Ed+ +++a+ ++G++ W+tIar ++ gRt++ +k++w++ 
   Cucsa.352560.1  63 PFTSDEDDTIIQAHSRFGNK-WATIARLLN-GRTDNAIKNHWNST 105
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.287459IPR017930Myb domain
SuperFamilySSF466895.99E-326102IPR009057Homeodomain-like
SMARTSM007173.9E-17857IPR001005SANT/Myb domain
PfamPF002491.1E-19954IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-261062IPR009057Homeodomain-like
CDDcd001673.90E-171153No hitNo description
SMARTSM007171.3E-1360108IPR001005SANT/Myb domain
PROSITE profilePS5129419.96861110IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2263109IPR009057Homeodomain-like
PfamPF002491.9E-1463105IPR001005SANT/Myb domain
CDDcd001671.42E-1163106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MATITDRIKG PWSPDEDELL RRLVHNYGPR NWSLISKSIP GRSGKSCRLR WCNQLSPEVE  60
HRPFTSDEDD TIIQAHSRFG NKWATIARLL NGRTDNAIKN HWNSTLKRKS SSSAPEDDHP  120
LKRSTSASAP PLYFNPSSPS GSDLSDSSLS GMSSSQVCKP FPPVPPLISH SNHPPMDTTS  180
IDPPTSLTLS LPGSDSX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-4281093104C-Myb DNA-Binding Domain
1msf_C3e-4281093104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141275.11e-141PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW14e-78MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0L3P91e-141A0A0A0L3P9_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s12410.12e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-71myb domain protein 77
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]